PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00019979-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 189aa    MW: 20556.6 Da    PI: 8.9543
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00019979-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.42.9e-161555747
                        HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        s +qv+fskRr g++KKA EL++ C++e   iifs+ gk++
  WALNUT_00019979-RA 15 SAQQVSFSKRRSGLFKKAGELCTICAVETDNIIFSPGGKVF 55
                        778***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554558.76E-18170IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.395161IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-10323IPR002100Transcription factor, MADS-box
PfamPF003199.3E-161556IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MGGKKTQKKT MQGASAQQVS FSKRRSGLFK KAGELCTICA VETDNIIFSP GGKVFSCGHH  60
SVEDVINMLG HRGKPDAVSI LEAEAHQERV LCDLKKQYSD LLEQLEAEKK RGEKLEQMKK  120
EGQVSSWFVT PIEELSFEEL KIQHAAMAEL RGKVLKNMAE RLAQGSAPSV AANSGGASDF  180
PVSKPKAAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1639169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-32AGAMOUS-like 61